PDB entry 1d5c

View 1d5c on RCSB PDB site
Description: crystal structure of plasmodium falciparum rab6 complexed with GDP
Class: endocytosis/exocytosis
Keywords: g-protein, gtpase, rab, rab6, vesicular trafficking, endocytosis-exocytosis complex
Deposited on 1999-10-06, released 2000-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rab6 gtpase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26000 (0-161)
      • modified residue (21)
      • modified residue (129)
      • modified residue (138)
    Domains in SCOPe 2.08: d1d5ca_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d5cA (A:)
kyklvflgeqavgktsiitrfmydtfdnnyqstigidflsktlyldegpvrlqlwdtagq
erfrslipsyirdsaaaivvyditnrqsfenttkwiqdilnergkdviialvgnktdlgd
lrkvtyeegmqkaqeyntmfhetsakaghnikvlfkktaskl