PDB entry 1d5b

View 1d5b on RCSB PDB site
Description:
Deposited on 1999-10-06, released 2000-02-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-09, with a file datestamp of 2000-02-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d5ba1, d1d5ba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d5bb1, d1d5bb2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d5bh1, d1d5bh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d5bl1, d1d5bl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5bA (A:)
    dikmtqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5bB (B:)
    qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5bH (H:)
    qvqlqqsgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
    nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d5bL (L:)
    dikmtqspssmyaslgervtitckasqdinsylnwfqqkpgkspktliyrtnrlvdgvps
    rfsgsgsgqdysltissleyedmgiyyclqydefpytfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr