PDB entry 1d4z

View 1d4z on RCSB PDB site
Description: crystal structure of chey-95iv, a hyperactive chey mutant
Class: signaling protein
Keywords: bacterial chemotaxis, response regulator, signaling protein
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-127)
    • mutation (93)
  Domains in SCOPe 2.07: d1d4za_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4zA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiradgamsalpvlmvtaeakkenviaaaqagasgyvvkpftaatleekln
  kifeklgm