PDB entry 1d4z

View 1d4z on RCSB PDB site
Description: crystal structure of chey-95iv, a hyperactive chey mutant
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOP 1.65 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1d4za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d4zA (A:)
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkenviaaaqagasgyvvkpftaatleekln
kifeklgm