PDB entry 1d4z

View 1d4z on RCSB PDB site
Description: crystal structure of chey-95iv, a hyperactive chey mutant
Class: signaling protein
Keywords: bacterial chemotaxis, response regulator, signaling protein
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06143 (0-127)
      • engineered mutation (93)
    Domains in SCOPe 2.08: d1d4za_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4zA (A:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
    nmdglellktiradgamsalpvlmvtaeakkenviaaaqagasgyvvkpftaatleekln
    kifeklgm