PDB entry 1d4x

View 1d4x on RCSB PDB site
Description: Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin Segment 1 at 1.75 A resolution.
Class: contractile protein
Keywords: actin, gelsolin s1, c.elegans, mg-ATP, contractile protein
Deposited on 1999-10-06, released 2001-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.199
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c. elegans actin 1/3
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4xa1, d1d4xa2
  • Chain 'G':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4xg_
  • Heterogens: MG, CA, SO4, ATP, SO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4xA (A:)
    cddevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqs
    krgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmt
    qimfetfntpamyvaiqavlslyasgrttgvvldsgdgvthtvpiyegyalphailrldl
    agrdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksy
    elpdgqvitvgnerfrcpeamfqpsflgmesagihetsynsimkcdidirkdlyantvls
    ggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskq
    eydesgpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4xA (A:)
    evaalvvdngsgmckagfagddapravfpsivgrprhqgvgqkdsyvgdeaqskrgiltl
    kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
    ntpamyvaiqavlslyasgrttgvvldsgdgvthtvpiyegyalphailrldlagrdltd
    ylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksyelpdgqv
    itvgnerfrcpeamfqpsflgmesagihetsynsimkcdidirkdlyantvlsggttmyp
    giadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqeydesgp
    sivhrkcf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1d4xG (G:)
    mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
    lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
    vasgfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4xG (G:)
    vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
    ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
    sgfk