PDB entry 1d4w
View 1d4w on RCSB PDB site
Description: crystal structure of the xlp protein sap in complex with slam phosphopeptide
Class: signaling protein
Keywords: sh2 domain, phosphotyrosine recogniiton, peptide recognition, signal transduction, lymphoproliferative disease, signaling protein
Deposited on
1999-10-06, released
1999-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.53
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: t cell signal transduction molecule sap
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1d4wa_ - Chain 'B':
Compound: t cell signal transduction molecule sap
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1d4wb_ - Chain 'C':
Compound: signaling lymphocytic activation molecule
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: signaling lymphocytic activation molecule
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1d4wA (A:)
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1d4wB (B:)
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
Sequence, based on observed residues (ATOM records): (download)
>1d4wB (B:)
avavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetg
swsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.