PDB entry 1d4u

View 1d4u on RCSB PDB site
Description: interactions of human nucleotide excision repair protein xpa with rpa70 and dna: chemical shift mapping and 15n nmr relaxation studies
Deposited on 1999-10-06, released 1999-10-17
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d4uA (A:)
mefdyviceecgkefmdsylmdhfdlptcddcrdaddkhklitkteakqeyllkdcdlek
repplkfivkknphhsqwgdmklylklqivkrslevwgsqealeeakevrq