PDB entry 1d4u

View 1d4u on RCSB PDB site
Description: interactions of human nucleotide excision repair protein xpa with rpa70 and DNA: chemical shift mapping and 15n nmr relaxation studies
Class: DNA binding protein
Keywords: DNA repair, loop-rich domain, nmr relaxation, DNA binding protein
Deposited on 1999-10-06, released 1999-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nucleotide excision repair protein xpa (xpa-mbd)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23025 (0-110)
  Domains in SCOPe 2.08: d1d4ua1, d1d4ua2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4uA (A:)
  mefdyviceecgkefmdsylmdhfdlptcddcrdaddkhklitkteakqeyllkdcdlek
  repplkfivkknphhsqwgdmklylklqivkrslevwgsqealeeakevrq