PDB entry 1d4t

View 1d4t on RCSB PDB site
Description: crystal structure of the xlp protein sap in complex with a slam peptide
Class: signaling protein
Keywords: sh2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.127
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell signal transduction molecule sap
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4ta_
  • Chain 'B':
    Compound: signaling lymphocytic activation molecule
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4tA (A:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'B':
    No sequence available.