PDB entry 1d4t

View 1d4t on RCSB PDB site
Description: crystal structure of the xlp protein sap in complex with a slam peptide
Class: signaling protein
Keywords: sh2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein
Deposited on 1999-10-06, released 1999-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t cell signal transduction molecule sap
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60880 (0-103)
  Domains in SCOPe 2.08: d1d4ta_
• Chain 'B':
  Compound: signaling lymphocytic activation molecule
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13291 (0-10)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4tA (A:)
  mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
  tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
  

  
  
• Chain 'B':
  No sequence available.