PDB entry 1d4s

View 1d4s on RCSB PDB site
Description: hiv-1 protease v82f/i84v double mutant/tipranavir complex
Class: hydrolase
Keywords: hydrolase, acid protease, aspartyl protease
Deposited on 1999-10-05, released 1999-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (hiv-1 protease)
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.08: d1d4sa_
• Chain 'B':
  Compound: protein (hiv-1 protease)
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.08: d1d4sb_
• Heterogens: TPV, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4sA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4sB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpfnvigrnlltqigctlnf