PDB entry 1d4q

View 1d4q on RCSB PDB site
Description: nmr structure of the ligand binding domain of the common beta-chain in the gm-csf, il-3 and il-5 receptors
Class: membrane protein
Keywords: beta sandwich, cytokine receptor, fn3 domain
Deposited on 1999-10-05, released 2000-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2000-06-21, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokine receptor common beta chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32927 (0-101)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1d4qa1, d1d4qa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4qA (A:)
    miqmappslnvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqnahs
    malpalepstrywarvrvrtsrtgyngiwsewsearswdtes