PDB entry 1d4o

View 1d4o on RCSB PDB site
Description: crystal structure of transhydrogenase domain III at 1.2 angstroms resolution
Class: oxidoreductase
Keywords: nucleotide-binding fold, protein-nadp(h) complex, inverted binding of nadp(h), oxidoreductase
Deposited on 1999-10-04, released 2000-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.167
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadp(h) transhydrogenase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4oa_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4oA (A:)
    meisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlseqgkkvrfgi
    hpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpns
    iiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvre
    syqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4oA (A:)
    gthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlseqgkkvrfgihpva
    grmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpnsiiag
    mpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvres