PDB entry 1d4n

View 1d4n on RCSB PDB site
Description: human serum transferrin
Deposited on 1999-10-04, released 2000-03-01
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-01, with a file datestamp of 2000-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d4na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4nA (A:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkestifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc