PDB entry 1d4n

View 1d4n on RCSB PDB site
Description: human serum transferrin
Class: metal transport
Keywords: iron transport, glycoprotein, transferrin, n-lobe, iron-release, carbonate, metal transport
Deposited on 1999-10-04, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02787 (0-328)
      • engineered (204)
    Domains in SCOPe 2.07: d1d4na_
  • Heterogens: CO3, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4nA (A:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkestifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc