PDB entry 1d4k

View 1d4k on RCSB PDB site
Description: hiv-1 protease complexed with a macrocyclic peptidomimetic inhibitor
Class: hydrolase
Keywords: hiv, protease, inhibitor, antiviral, structure, hydrolase
Deposited on 1999-10-04, released 2000-10-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.02: d1d4ka_
• Chain 'B':
  Compound: hiv-1 protease
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.02: d1d4kb_
• Heterogens: SO4, PI8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4kA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d4kB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf