PDB entry 1d4g

View 1d4g on RCSB PDB site
Description: crystal structure of s-adenosylhomocysteine hydrolase (adohcyase) complexed with a potent inhibitor d-eritadenine
Deposited on 1999-10-04, released 2001-01-17
The last revision was dated 2006-03-14, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'B':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'C':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'D':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'E':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'F':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'G':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Chain 'H':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (0-429)
      • conflict (83)
      • conflict (331)
  • Heterogens: NAD, DEA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gA (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gB (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gC (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gD (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gE (E:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gF (F:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gG (G:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1d4gH (H:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqnhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllkngrriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry