PDB entry 1d4f

View 1d4f on RCSB PDB site
Description: crystal structure of recombinant rat-liver d244e mutant s-adenosylhomocysteine hydrolase
Class: hydrolase
Keywords: S-adenosylhomocysteine hydrolase, AdoHcyase, AdoHcy, Mutagenesis, X-ray crystal structure, Enzyme structure
Deposited on 2000-06-22, released 2001-01-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (243)
    Domains in SCOPe 2.05: d1d4fa1, d1d4fa2
  • Chain 'B':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (243)
    Domains in SCOPe 2.05: d1d4fb1, d1d4fb2
  • Chain 'C':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (243)
    Domains in SCOPe 2.05: d1d4fc1, d1d4fc2
  • Chain 'D':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (243)
    Domains in SCOPe 2.05: d1d4fd1, d1d4fd2
  • Heterogens: NAD, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4fA (A:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4fA (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d4fB (B:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4fB (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d4fC (C:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4fC (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d4fD (D:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4fD (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry