PDB entry 1d4f

View 1d4f on RCSB PDB site
Description: crystal structure of recombinant rat-liver d244e mutant s- adenosylhomocysteine hydrolase
Deposited on 2000-06-22, released 2001-01-17
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4fA (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4fB (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4fC (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d4fD (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry