PDB entry 1d4d

View 1d4d on RCSB PDB site
Description: crystal structure of the succinate complexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
Deposited on 1999-10-03, released 1999-12-01
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-01, with a file datestamp of 1999-11-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4dA (A:)
    aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
    hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
    agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
    aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
    vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
    yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdlq
    yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
    fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
    erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektakpitglyaagevtggv
    hganrlggnaisdivtygriagasaakfakdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4dA (A:)
    vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapvsphkshlig
    eiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaiaagvkett
    dvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpqaklgied
    kkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggasvnrshrp
    tggagvgahvaqvlwdnavkrgtdirlnsrvvriledgkvtgvlvkgeytgyyvikadav
    viaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdlqyiqahptys
    paggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylvfddsirksl
    kaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvsgkdaqferpdlprelv
    vapfyaleiapavhhtmgglvidtkaevksektakpitglyaagevtggvhganrlggna
    isdivtygriagasaakfak