PDB entry 1d4d

View 1d4d on RCSB PDB site
Description: crystal structure of the succinate complexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
Class: oxidoreductase
Keywords: tetraheme flavocytochrome c fumarate reductase, OXIDOREDUCTASE
Deposited on 1999-10-03, released 1999-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavocytochrome c fumarate reductase
    Species: Shewanella oneidensis [TaxId:70863]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d4da1, d1d4da2, d1d4da3
  • Heterogens: HEM, FAD, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d4dA (A:)
    aapevladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsp
    hkshligeiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaia
    agvkettdvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpq
    aklgiedkkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggas
    vnrshrptggagvgahvaqvlwdnavkrgtdirlnsrvvriledasgkvtgvlvkgeytg
    yyvikadavviaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdlq
    yiqahptyspaggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylv
    fddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqf
    erpdlprelvvapfyaleiapavhhtmgglvidtkaevksektakpitglyaagevtggv
    hganrlggnaisdivtygriagasaakfakdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d4dA (A:)
    vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapvsphkshlig
    eiactschkgheksvaycdachsfgfdmpfggkwerkfvpvdadkaaqdkaiaagvkett
    dvviigsggaglaaavsardagakvillekepipggntklaaggmnaaetkpqaklgied
    kkqimiddtmkggrnindpelvkvlannssdsidwltsmgadmtdvgrmggasvnrshrp
    tggagvgahvaqvlwdnavkrgtdirlnsrvvriledgkvtgvlvkgeytgyyvikadav
    viaaggfaknnervskydpklkgfkatnhpgatgdgldvalqagaatrdlqyiqahptys
    paggvmiteavrgngaivvnregnrfmneittrdkasaailqqkgesaylvfddsirksl
    kaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvsgkdaqferpdlprelv
    vapfyaleiapavhhtmgglvidtkaevksektakpitglyaagevtggvhganrlggna
    isdivtygriagasaakfak