PDB entry 1d4b

View 1d4b on RCSB PDB site
Description: cide-n domain of human cide-b
Class: apoptosis
Keywords: alpha/beta roll, apoptosis
Deposited on 1999-10-02, released 1999-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human cell death-inducing effector b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d4ba1, d1d4ba2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d4bA (A:)
meylsalnpsdllrsvsnissefgrrvwtsapppqrpfrvcdhkrtirkgltaatrqell
akaletlllngvltlvleedgtavdsedffqlleddtclmvlqsgqswsptrsgvlhhhh
hh