PDB entry 1d3y

View 1d3y on RCSB PDB site
Description: structure of the dna topoisomerase vi a subunit
Deposited on 1999-10-01, released 1999-11-05
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-05, with a file datestamp of 1999-11-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d3ya_
  • Chain 'B':
    Domains in SCOP 1.55: d1d3yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d3yA (A:)
    qakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaalg
    vlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletdad
    filaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdgd
    pygylniyrtlkvgsgkaihladklsipaarligvtpqdiidydlpthplkeqdikrikd
    glknddfvrsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3yA (A:)
    qakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaalg
    vlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletdad
    filaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdgd
    pygylniyrtlkvdklsipaarligvtpqdiidydlpthplkeqdikrikdglknddfvr
    sfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d3yB (B:)
    nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
    gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
    dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
    dpygylniyrtlkvgsgkaihladklsipaarligvtpqdiidydlpthplkeqdikrik
    dglknddfvrsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3yB (B:)
    nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
    gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
    dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
    dpygylniyrtlkvgklsipaarligvtpqdiidydlpthplkeqdikrikdglknddfv
    rsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp