PDB entry 1d3y

View 1d3y on RCSB PDB site
Description: structure of the DNA topoisomerase vi a subunit
Class: isomerase
Keywords: topoisomerase vi, DNA binding protein, spo11 homolog
Deposited on 1999-10-01, released 1999-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase vi a subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3ya_
  • Chain 'B':
    Compound: DNA topoisomerase vi a subunit
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3yb_
  • Heterogens: NA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d3yA (A:)
    tvnqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedlea
    algvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnlet
    dadfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvft
    dgdpygylniyrtlkvgsgkaihladklsipaarligvtpqdiidydlpthplkeqdikr
    ikdglknddfvrsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwl
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3yA (A:)
    qakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaalg
    vlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletdad
    filaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdgd
    pygylniyrtlkvdklsipaarligvtpqdiidydlpthplkeqdikrikdglknddfvr
    sfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d3yB (B:)
    tvnqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedlea
    algvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnlet
    dadfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvft
    dgdpygylniyrtlkvgsgkaihladklsipaarligvtpqdiidydlpthplkeqdikr
    ikdglknddfvrsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwl
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3yB (B:)
    nqakifaqttkmlefakqlletddfstlreayyvsknwgearfddqqasnnviedleaal
    gvlrehlgfipeedgssvvgplkiieetpegelvvdctklgtgaynipndvtklnletda
    dfilaietsgmfarlnaerfwdkhncilvslkgvparatrrfikrlheehdlpvlvftdg
    dpygylniyrtlkvgklsipaarligvtpqdiidydlpthplkeqdikrikdglknddfv
    rsfpewqkalkqmldmgvraeqqslakyglkyvvntylpekikdestwlp