PDB entry 1d3u

View 1d3u on RCSB PDB site
Description: tata-binding protein/transcription factor (II)b/bre+tata-box complex from pyrococcus woesei
Class: gene regulation/DNA
Keywords: protein-DNA complex, transcription, hyperthermophile, gene regulation/DNA complex
Deposited on 1999-10-01, released 1999-11-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata-binding protein
    Species: Pyrococcus woesei [TaxId:2262]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d3ua1, d1d3ua2
  • Chain 'B':
    Compound: transcription initiation factor iib
    Species: Pyrococcus woesei [TaxId:2262]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61999 (0-200)
      • engineered (0)
    Domains in SCOPe 2.05: d1d3ub1, d1d3ub2
  • Chain 'C':
    Compound: DNA 24-mer: bre+tata-box
    Species:
    Gene:
  • Chain 'D':
    Compound: DNA 23-mer: bre+tata-box
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3uA (A:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    y
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3uB (B:)
    mvsdaaernlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacv
    yaacrllkvprtldeiadiarvdkkeigrsyrfiarnlnltpkklfvkptdyvnkfadel
    glsekvrrraieildeaykrgltsgkspaglvaaalyiasllegekrtqrevaevarvte
    vtvrnrykelveklkikvpia
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.