PDB entry 1d3u

View 1d3u on RCSB PDB site
Description: tata-binding protein/transcription factor (ii)b/bre+tata-box complex from pyrococcus woesei
Deposited on 1999-10-01, released 1999-11-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-15, with a file datestamp of 1999-11-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3uA (A:)
    mvdmskvklrienivasvdlfaqldlekvldlcpnskynpeefpgiichlddpkvallif
    ssgklvvtgaksvqdieravaklaqklksigvkfkrapqidvqnmvfsgdigrefnldvv
    altlpnceyepeqfpgviyrvkepksvillfssgkivcsgakseadaweavrkllreldk
    y
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3uB (B:)
    mvsdaaernlafalseldritaqlklprhveeeaarlyreavrkglirgrsiesvmaacv
    yaacrllkvprtldeiadiarvdkkeigrsyrfiarnlnltpkklfvkptdyvnkfadel
    glsekvrrraieildeaykrgltsgkspaglvaaalyiasllegekrtqrevaevarvte
    vtvrnrykelveklkikvpia