PDB entry 1d3n

View 1d3n on RCSB PDB site
Description: methionine core mutation
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, methionine core mutant, selenomethionine, protein engineering, protein folding
Deposited on 1999-09-29, released 1999-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: GENE E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • modified residue (0)
      • modified residue (5)
      • engineered (53)
      • engineered (83)
      • engineered (90)
      • engineered (96)
      • engineered (98)
      • modified residue (101)
      • modified residue (105)
      • engineered (117)
      • modified residue (119)
      • engineered (120)
    Domains in SCOPe 2.07: d1d3na_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d3nA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnakmkpvydsmdavrraaminmvfqmgetgvagftnsmrm
    mqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3nA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnakmkpvydsmdavrraaminmvfqmgetgvagftnsmrm
    mqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk