PDB entry 1d3l

View 1d3l on RCSB PDB site
Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.
Deposited on 1999-09-29, released 1999-11-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-01, with a file datestamp of .
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.371
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3lA (A:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtf