PDB entry 1d3l

View 1d3l on RCSB PDB site
Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.
Class: cell adhesion
Keywords: rhinovirus receptor, adhesion protein, glycoprotein, immunoglobulin fold, cell adhesion
Deposited on 1999-09-29, released 1999-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.371
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (intercellular adhesion molecule-1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d3la1, d1d3la2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3lA (A:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtf