PDB entry 1d3i

View 1d3i on RCSB PDB site
Description: cryo-em structure of human rhinovirus 14 (hrv14) complexed with a two-domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only
Class: Virus/Receptor
Keywords: HUMAN RHINOVIRUS, HRV14, ICAM-1, CRYO-ELECTRON MICROSCOPY, FITTING OF X-RAY STRUCTURES INTO CRYO-EM RECONSTRUCTIONS, COMMON COLD, VIRUS UNCOATING, VIRUS/ VIRAL PROTEIN, RHINOVIRUS-RECEPTOR COMPLEX, Icosahedral virus, Virus/Receptor COMPLEX
Deposited on 1999-09-29, released 2000-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: EM
Resolution: 26 Å
R-factor: N/A
AEROSPACI score: -0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: protein (rhinovirus 14 coat protein vp1)
    Species: Human rhinovirus sp. [TaxId:169066]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3i1_
  • Chain '2':
    Compound: protein (rhinovirus 14 coat protein vp2)
    Species: Human rhinovirus sp. [TaxId:169066]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3i2_
  • Chain '3':
    Compound: protein (rhinovirus 14 coat protein vp3)
    Species: Human rhinovirus sp. [TaxId:169066]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3i3_
  • Chain '4':
    Compound: protein (rhinovirus 14 coat protein vp4)
    Species: Human rhinovirus sp. [TaxId:169066]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3i4_
  • Chain 'I':
    Compound: protein (intercellular adhesion molecule-1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d3ii_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1d3i1 (1:)
    glgdeleevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhf
    ngsetdvecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelft
    yvrfdseytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkv
    gdtsrfsvpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvk
    irvyhrakhveawiprapralpytsigrtnypkntepvikkrkgdiksy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3i1 (1:)
    tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
    vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
    pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
    yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
    apralpytsigrtnypkntepvikkrkgdiksy
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1d3i2 (2:)
    spnveacgysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsv
    crfytldsktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsg
    cllvvvipehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgn
    llifphqfinlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpi
    tvtiapmctefsgirsksivpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3i2 (2:)
    gysdrvqqitlgnstittqeaanavvcyaewpeylpdvdasdvnktskpdtsvcrfytld
    sktwttgskgwcwklpdalkdmgvfgqnmffhslgrsgytvhvqcnatkfhsgcllvvvi
    pehqlasheggnvsvkytfthpgergidlssanevggpvkdvlynmngtllgnllifphq
    finlrtnntativipyinsvpidsmtrhnnvslmvipiapltvptgatpslpitvtiapm
    ctefsgirsksivpq
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3i3 (3:)
    glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
    kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
    alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
    ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1d3i4 (4:)
    gaqvstqksgshenqniltngsnqtftvinyykdaastssagqslsmdpskftepvkdlm
    lkgapaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d3i4 (4:)
    inyykdaastssagqslsmdpskftepvkdlmlkgapaln
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3iI (I:)
    qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
    sqpmcysncpdgqstaktfltvywtpervelaplpswqpvgknltlrcqveggapranlt
    vvllrgekelkrepavgepaevtttvlvrrdhhganfscrteldlrpqglelfentsapy
    qlqtf