PDB entry 1d3b

View 1d3b on RCSB PDB site
Description:
Deposited on 1998-12-22, released 1999-12-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3ba_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bd_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3be_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bf_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bg_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bh_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bi_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bj_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bk_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1d3bl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bA (A:)
    gvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyi
    rgckirflilpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bB (B:)
    skmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaereekrv
    lglvllrgenlvsmtvegppp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bC (C:)
    vpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyir
    gckirflilpd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bD (D:)
    tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
    eekrvlglvllrgenlvsmtvegppp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bE (E:)
    sigvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqv
    yirgckirflilpd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bF (F:)
    ksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaereek
    rvlglvllrgenlvsmtvegppp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bG (G:)
    igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
    irgckirflilpd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bH (H:)
    vgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaere
    ekrvlglvllrgenlvsmtvegpppk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bI (I:)
    igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
    irgckirflilpd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bJ (J:)
    tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
    eekrvlglvllrgenlvsmtvegppp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bK (K:)
    vpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyir
    gckirflilpd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3bL (L:)
    tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
    eekrvlglvllrgenlvsmtvegpppkdtg