PDB entry 1d3a

View 1d3a on RCSB PDB site
Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form
Deposited on 1999-09-28, released 2000-03-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-28, with a file datestamp of 2000-06-28.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3aA (A:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d3aB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis