PDB entry 1d2u

View 1d2u on RCSB PDB site
Description: 1.15 a crystal structure of nitrophorin 4 from rhodnius prolixus
Class: transport protein
Keywords: nitric oxide transport, ferric heme, antihistamine, vasodilator, lipocalin, bilan binding protein, transport protein
Deposited on 1999-09-28, released 2001-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.13
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d2ua_
  • Heterogens: HEM, NH3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2uA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk