PDB entry 1d2s

View 1d2s on RCSB PDB site
Description: crystal structure of the n-terminal laminin g-like domain of shbg in complex with dihydrotestosterone
Class: transport protein
Keywords: steroid transport, laminin g-like domain, jellyroll, androgen binding protein (abp), sex steroid binding protein (sbp), transport protein
Deposited on 1999-09-28, released 2000-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex hormone-binding globulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d2sa_
  • Heterogens: CA, DHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2sA (A:)
    ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
    dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsghpi
    mrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc