PDB entry 1d2r

View 1d2r on RCSB PDB site
Description: 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site.
Deposited on 1999-09-27, released 2000-04-05
The last revision prior to the SCOP 1.59 freeze date was dated 2000-04-05, with a file datestamp of 2000-04-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1d2ra_
  • Chain 'B':
    Domains in SCOP 1.59: d1d2rb_
  • Chain 'C':
    Domains in SCOP 1.59: d1d2rc_
  • Chain 'D':
    Domains in SCOP 1.59: d1d2rd_
  • Chain 'E':
    Domains in SCOP 1.59: d1d2re_
  • Chain 'F':
    Domains in SCOP 1.59: d1d2rf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2rA (A:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2rB (B:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2rC (C:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2rD (D:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2rE (E:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2rF (F:)
    mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
    laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
    glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
    arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
    llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
    degaekanrvasemvrkmeqamglgr