PDB entry 1d2q

View 1d2q on RCSB PDB site
Description: crystal structure of human trail
Class: cytokine
Keywords: trail, cytokine
Deposited on 1999-09-27, released 2000-02-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1d2qa_
  • Chain 'B':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1d2qb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2qA (A:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2qA (A:)
    rvaahitgtrgntlsknekalgrkinswessghsflsnlhlrngelvihekgfyyiysqt
    yfrqmvqyiykytsypdpillmksarnscyglysiyqggifelkendrifvsvtnehlid
    mdheasffgaflvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d2qB (B:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2qB (B:)
    rvaahitgtrgntlsknekalgrkinswessghsflsnlhlrngelvihekgfyyiysqt
    yfrqmvqyiykytsypdpillmksarnscyglysiyqggifelkendrifvsvtnehlid
    mdheasffgaflvg