PDB entry 1d2p

View 1d2p on RCSB PDB site
Description: crystal structure of two b repeat units (b1b2) of the collagen binding protein (cna) of staphylococcus aureus
Class: structural protein
Keywords: collagen, igg, igsf, mscramm, cna, staphylococcus aureus, structural protein
Deposited on 1999-09-25, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen adhesin
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53654 (0-372)
      • conflict (4-5)
      • conflict (180)
      • conflict (191-192)
      • conflict (218)
      • conflict (367)
    Domains in SCOPe 2.07: d1d2pa1, d1d2pa2, d1d2pa3, d1d2pa4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2pA (A:)
    ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
    kkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpteikvely
    qdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdnndmgnli
    ttnkytpettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkd
    lpkydegkkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpt
    eikvelyqdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdn
    ndmgnlittnkyt