PDB entry 1d2o

View 1d2o on RCSB PDB site
Description: crystal structure of a single b repeat unit (b1) of collagen binding surface protein (cna) of staphylococcus aureus.
Class: structural protein
Keywords: beta sandwich, igg, igsf, cna, staphylococcus aureus, collagen, structural protein
Deposited on 1999-09-25, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen adhesin
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53654 (0-186)
      • conflict (4-5)
      • conflict (180)
    Domains in SCOPe 2.07: d1d2oa1, d1d2oa2
  • Chain 'B':
    Compound: collagen adhesin
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53654 (0-186)
      • conflict (4-5)
      • conflict (180)
    Domains in SCOPe 2.07: d1d2ob1, d1d2ob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2oA (A:)
    ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
    kkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpteikvely
    qdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdnndmgnli
    ttnkytp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2oB (B:)
    ettssigekvwddkdnqdgkrpekvsvnllangekvktldvtsetnwkyefkdlpkydeg
    kkieytvtedhvkdyttdingttitnkytpgetsatvtknwddnnnqdgkrpteikvely
    qdgkatgktailnesnnwthtwtgldekakgqqvkytveeltkvkgytthvdnndmgnli
    ttnkytp