PDB entry 1d2n

View 1d2n on RCSB PDB site
Description: d2 domain of n-ethylmaleimide-sensitive fusion protein
Class: hexamerization domain
Keywords: hexamerization domain, ATPase, transport
Deposited on 1998-06-30, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-ethylmaleimide-sensitive fusion protein
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2na_
  • Heterogens: MG, ANP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2nA (A:)
    mrgshhhhhhgstmdikpafgtnqedyasyimngiikwgdpvtrvlddgellvqqtknsd
    rtplvsvllegpphsgktalaakiaeesnfpfikicspdkmigfsetakcqamkkifdda
    yksqlscvvvddierlldyvpigprfsnlvlqallvllkkappqgrklliigttsrkdvl
    qememlnafsttihvpniatgeqllealellgnfkdkerttiaqqvkgkkvwigikkllm
    liemslqmdpeyrvrkflallreegaspldfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2nA (A:)
    edyasyimngiikwgdpvtrvlddgellvqqtknsdrtplvsvllegpphsgktalaaki
    aeesnfpfikicspdkmigfsetakcqamkkifddayksqlscvvvddierlldyvpigp
    rfsnlvlqallvllkkappqgrklliigttsrkdvlqememlnafsttihvpniatgeql
    lealellgnfkdkerttiaqqvkgkkvwigikkllmliemslqmdpeyrvrkflallree
    gaspld