PDB entry 1d2m

View 1d2m on RCSB PDB site
Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme
Class: hydrolase
Keywords: MULTIDOMAIN PROTEIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 1999-09-25, released 2000-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: excinuclease abc subunit b
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2ma1, d1d2ma2
  • Heterogens: BOG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2mA (A:)
    mtfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvl
    apnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlr
    hsttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqr
    ndidlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlf
    pathylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpg
    venyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdyg
    frlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirptglldplvrvk
    ptenqildlmegireraargertlvtvltvrmaeeltsflvehgirarylhheldafkrq
    alirdlrlghydclvginllregldipevslvaildadkegflrsersliqtigraarna
    rgevwlyadrvseamqraieetnrrralqeaynlehgitpetvrkevravirpegyeeap
    leadlsgedlreriaelelamwqaaealdferaarlrdeiralearlqgvrapepvpggr
    krkrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2mA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvvrevllerllelgyqrndidlspg
    rfrakgevleifpayetepirvelgfvlfpathylspegleeilkeiekelwervryfee
    rgevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppytlldyfpedflvf
    ldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeeflervsqvvfvsatp
    gpfelahsgrvveqiirptglldplvrvkptenqildlmegireraargertlvtvltvr
    maeeltsflvehgirarylhheldafkrqalirdlrlghydclvginllregldipevsl
    vaildadkegflrsersliqtigraarnargevwlyadrvseamqraieetnrrralqea
    ynlehgitpetv