PDB entry 1d2l

View 1d2l on RCSB PDB site
Description: nmr solution structure of complement-like repeat cr3 from the low density lipoprotein receptor-related protein (lrp). evidence for specific binding to the receptor binding domain of human alpha-2 macroglobulin
Class: signaling protein
Keywords: ligand binding, calcium binding, complement-like repeat, receptor, signaling protein
Deposited on 1999-09-24, released 2000-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoprotein receptor related protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07954 (2-44)
      • expression artifact (0-1)
    Domains in SCOPe 2.07: d1d2la_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2lA (A:)
    gsppqcqpgefacansrciqerwkcdgdndcldnsdeapalchqh