PDB entry 1d2l

View 1d2l on RCSB PDB site
Description: nmr solution structure of complement-like repeat cr3 from the low density lipoprotein receptor-related protein (lrp). evidence for specific binding to the receptor binding domain of human alpha-2 macroglobulin
Deposited on 1999-09-24, released 2000-01-14
The last revision prior to the SCOP 1.65 freeze date was dated 2000-02-21, with a file datestamp of 2000-02-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1d2la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2lA (A:)
    gsppqcqpgefacansrciqerwkcdgdndcldnsdeapalchqh