PDB entry 1d2i

View 1d2i on RCSB PDB site
Description: crystal structure of restriction endonuclease bglii complexed with DNA 16-mer
Class: hydrolase/DNA
Keywords: restriction endonuclease, restriction enzyme, protein-DNA complex, hydrolase-DNA complex
Deposited on 1999-09-23, released 2000-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (restriction endonuclease bglii)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2ia_
  • Chain 'B':
    Compound: protein (restriction endonuclease bglii)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2ib_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*tp*ap*tp*ap*gp*ap*tp*cp*tp*ap*tp*ap*a)-3')
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*tp*ap*tp*ap*gp*ap*tp*cp*tp*ap*tp*ap*a)-3')
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2iA (A:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d2iB (B:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntpntrrrkrgtivty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2iB (B:)
    mkiditdynhadeilnpqlwkeieetllkmplhvkasdqaskvgslifdpvgtnqyikde
    lvpkhwknnipipkrfdflgtdidfgkrdtlvevqfsnypfllnntvrselfhksnmdid
    eegmkvaiiitkghmfpasnsslyyeqaqnqlnslaeynvfdvpirlvgliedfetdidi
    vsttyadkrysrtitkrdtvkgkvidtntrkrgtivty
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.