PDB entry 1d2h

View 1d2h on RCSB PDB site
Description: crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine
Class: transferase
Keywords: methyltransferase, transferase
Deposited on 1999-10-11, released 1999-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13255 (Start-291)
      • engineered (88)
    Domains in SCOPe 2.07: d1d2ha_
  • Chain 'B':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13255 (Start-291)
      • engineered (88)
    Domains in SCOPe 2.07: d1d2hb_
  • Chain 'C':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13255 (Start-291)
      • engineered (88)
    Domains in SCOPe 2.07: d1d2hc_
  • Chain 'D':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13255 (Start-291)
      • engineered (88)
    Domains in SCOPe 2.07: d1d2hd_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2hA (A:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2hA (A:)
    taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
    rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
    asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
    tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
    pcyfihvlkktg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d2hB (B:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2hB (B:)
    taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
    rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
    asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
    tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
    pcyfihvlkktg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d2hC (C:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2hC (C:)
    taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
    rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
    asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
    tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
    pcyfihvlkktg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d2hD (D:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2hD (D:)
    taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
    rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
    asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
    tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
    pcyfihvlkktg