PDB entry 1d2g

View 1d2g on RCSB PDB site
Description: crystal structure of r175k mutant glycine n-methyltransferase from rat liver
Class: transferase
Keywords: methyltransferase
Deposited on 1999-10-08, released 1999-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13255 (0-291)
      • engineered (88)
    Domains in SCOPe 2.07: d1d2ga_
  • Chain 'B':
    Compound: glycine n-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13255 (0-291)
      • engineered (88)
    Domains in SCOPe 2.07: d1d2gb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2gA (A:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2gB (B:)
    vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
    ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
    dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhknydyi
    lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
    syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg