PDB entry 1d2e

View 1d2e on RCSB PDB site
Description: crystal structure of mitochondrial ef-tu in complex with gdp
Deposited on 1999-09-23, released 1999-09-28
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-20, with a file datestamp of 2000-03-20.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.237
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eA (A:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eB (B:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eC (C:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2eD (D:)
    kphvnvgtighvdhgkttltaaitkilaegggakfkkyeeidnapeerargitinaahve
    ystaarhyahtdcpghadyvknmitgtapldgcilvvaandgpmpqtrehlllarqigve
    hvvvyvnkadavqdsemvelveleirelltefgykgeetpiivgsalcaleqrdpelglk
    svqklldavdtyipvptrdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflg
    hsknirtvvtgiemfhksldraeagdnlgalvrglkredlrrglvmakpgsiqphqkvea
    qvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltlilrqpm
    ilekgqrftlrdgnrtigtglvtdtpamteedknikw