PDB entry 1d2b

View 1d2b on RCSB PDB site
Description: the mmp-inhibitory, n-terminal domain of human tissue inhibitor of metalloproteinases-1 (n-timp-1), solution nmr, 29 structures
Class: hydrolase inhibitor
Keywords: ob-fold, beta barrel, protease inhibitor, mmp inhibitor, hydrolase inhibitor
Deposited on 1999-09-22, released 1999-12-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tissue inhibitor of metalloproteinases-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01033 (0-125)
  Domains in SCOPe 2.01: d1d2ba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d2bA (A:)
  ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
  vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
  tvgcee