PDB entry 1d2b

View 1d2b on RCSB PDB site
Description: the mmp-inhibitory, n-terminal domain of human tissue inhibitor of metalloproteinases-1 (n-timp-1), solution nmr, 29 structures
Deposited on 1999-09-22, released 1999-12-22
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1d2ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2bA (A:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee