PDB entry 1d2a

View 1d2a on RCSB PDB site
Description: crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the activator adenine
Deposited on 1999-09-22, released 2000-02-23
The last revision prior to the SCOP 1.57 freeze date was dated 2000-02-23, with a file datestamp of 2000-02-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d2aa_
  • Chain 'B':
    Domains in SCOP 1.57: d1d2ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2aA (A:)
    pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
    ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
    tvqtiiedpwygdiqdfeynfkqityfskqflkkel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2aB (B:)
    pkisvafialgnfcrspmaeaifkhevekanlenrfnkidsfgtsnyhvgespdhrtvsi
    ckqhgvkinhkgkqiktkhfdeydyiigmdesninnlkkiqpegskakvclfgdwntndg
    tvqtiiedpwygdiqdfeynfkqityfskqflkkel