PDB entry 1d1z

View 1d1z on RCSB PDB site
Description: crystal structure of the xlp protein sap
Class: gene regulation
Keywords: sh2 domains, gene regulation
Deposited on 1999-09-22, released 1999-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.147
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sap sh2 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1za_
  • Chain 'B':
    Compound: sap sh2 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1zb_
  • Chain 'C':
    Compound: sap sh2 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1zc_
  • Chain 'D':
    Compound: sap sh2 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1zd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d1zA (A:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1zA (A:)
    vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
    wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d1zB (B:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1zB (B:)
    vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvssaetap
    gvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d1zC (C:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1zC (C:)
    vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
    wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d1zD (D:)
    mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
    tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d1zD (D:)
    vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
    wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek